PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_37712
Common NameKK1_037560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 582aa    MW: 64601.6 Da    PI: 6.5418
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_37712genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.99.5e-29372423152
         RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    aek+isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  C.cajan_37712 372 AEKTISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 423
                    589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.348362443IPR003035RWP-RK domain
PfamPF020422.5E-24376423IPR003035RWP-RK domain
SuperFamilySSF542771.24E-21486572No hitNo description
Gene3DG3DSA:3.10.20.2402.4E-22486566No hitNo description
SMARTSM006668.8E-22486569IPR000270PB1 domain
PROSITE profilePS5174518.407486569IPR000270PB1 domain
CDDcd064071.60E-36487568No hitNo description
PfamPF005648.2E-13487568IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MQIWVPERGG GGGGGGVGPG PDESVWGGYP MNMNMNMNMN MNMNMNMNMN MNMNMMNRSI  60
RVGFLRWEEG VPYGYEEGPG WMGLPVLERG SGKCLGVLHI EYEYEGGVEG AVNEVVEVLT  120
CVCKAQNLPL ALTWAPCTQA KCGYGHSHSN YVSTVDRACF VGDAHLLPFH EVCSDHHLLR  180
GQGIVGTAFT TAKPCFATDI TAFTNDEYPL AHHASVLGLH AAVAIPLRSV STDFVVELFL  240
PKDCLLREHQ NHLLNSLSLL LQQACRSLHV VTEDELSFPF PQVVEEQSWI ANMMEAQAQK  300
GKGVCVSLEY LELEEPMEEF KVTSNCNWDK TPSYVEEQQV FSDFIAQDSQ THTHTFSARR  360
GRKSGEKRRT KAEKTISLPV LRQYFAGSLK DAAKSIGVCP TTLKRICRQH GITRWPSRKI  420
KKVGHSLKKL QLVIDSVQGA EGSIQIGSFY SSFPELSSAA PCESKNKNIN NSLHGHAESP  480
VGVAVALRVK ATFADEKIRF SLQQVWGFAE LQVEIARRFN LNEMRSVVLK YLDDEGEWVV  540
LACDADLEEC KDLHTASHNR TIRLALFQAS PPNTFPYPSP ST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-31AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142568.10.0hypothetical protein PHAVU_008G291800g
RefseqXP_007142569.10.0hypothetical protein PHAVU_008G291800g
SwissprotQ7X9B91e-118NLP2_ARATH; Protein NLP2
TrEMBLA0A151REN60.0A0A151REN6_CAJCA; Uncharacterized protein
STRINGGLYMA02G48080.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.11e-108Nin-like family protein